Zu "GeneID 947577" wurden 1 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)
RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S...

Artikelnummer: 375158.100

Source:, Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD, AA Sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
Schlagworte: rpsU, b3065, 30S ribosomal protein S21, Small ribosomal subunit protein bS21
MW: 35,4
ab 636,00 €
Bewerten